{"product_id":"proteintech-11937-1-ap","title":"Proteintech, 11937-1-AP, MAPKSP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAPKSP1 (11937-1-AP) by Proteintech is a Polyclonal antibody targeting MAPKSP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11937-1-AP targets MAPKSP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue,  L02 cells,  mouse brain tissue,  mouse liver tissue\nPositive IHC detected in: human prostate cancer tissue,  human heart tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAPKSP1, also named as mitogen activated protein kinase kinase 1 interacting protein 1, Map2k1ip1, MEK partner 1, Lamtor3 and MP1. It was first identified as a scaffold protein enhancing the efficiency of the MAPK pathway by facilitating the interaction between MEK1 and ERK1 upon serum stimulation (PMID: 9733512). Later, it has been demonstrated that MAPKSP1 enhances activation of both ERK1 and ERK2 as a response to EGF (PMID: 12479806) and fibronectin (PMID: 15923628). MAPKSP1 is involved in regulating endosomal signaling (PMID: 17178906), and a role in cancer, via MEK and ERK hyperactivation, has been demostrated in pancreatic tumorigenesis (PMID: 24209743). MAPKSP1 has two isoforms with the molecular weight of 13-14 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2534 Product name: Recombinant human MAPKSP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC026245 Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS Predict reactive species\nFull Name: MAPK scaffold protein 1\nCalculated Molecular Weight: 124 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC026245\nGene Symbol: MAPKSP1\nGene ID (NCBI): 8649\nRRID: AB_2141610\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHA4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869558100137,"sku":"11937-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11937-1-ap","provider":"Iright","version":"1.0","type":"link"}