{"product_id":"proteintech-11959-1-ap","title":"Proteintech, 11959-1-AP, SPRR1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPRR1B (11959-1-AP) by Proteintech is a Polyclonal antibody targeting SPRR1B in IHC, ELISA applications with reactivity to human samples\n11959-1-AP targets SPRR1B in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThis protein functions as a component of the cross-linked envelope in squamous differentiating cells. It runs as a  15-kDa protein in unreducing SDS PAGE, whereas under reducing conditions it runs as  23 kDa one.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2563 Product name: Recombinant human SPRR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC056240 Sequence: MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK Predict reactive species\nFull Name: small proline-rich protein 1B (cornifin)\nCalculated Molecular Weight: 89 aa, 10 kDa\nGenBank Accession Number: BC056240\nGene Symbol: SPRR1B\nGene ID (NCBI): 6699\nRRID: AB_2877807\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22528\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869604860073,"sku":"11959-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11959-1-ap","provider":"Iright","version":"1.0","type":"link"}