{"product_id":"proteintech-12023-2-ap","title":"Proteintech, 12023-2-AP, NUCKS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUCKS1 (12023-2-AP) by Proteintech is a Polyclonal antibody targeting NUCKS1 in WB, IP, IHC, ELISA applications with reactivity to human, rat samples\n12023-2-AP targets NUCKS1 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HEK-293 cells,  MCF-7 cells,  SW 1990 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human gliomas tissue, rat pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNuclear ubiquitous casein and cyclin-dependent kinase substrate 1 (NUCKS1) is a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated by CDK1 and casein kinase during mitosis of the cell cycle. Phosphorylated upon DNA damage, probably by ATM or ATR. Widelyexpressed, with highest levels in thyroid gland, prostate and uterus and in fetal liver, thymus and lung. Two isoforms of NUCKS1 exist due to alternative splicing events.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2652 Product name: Recombinant human NUCKS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-243 aa of BC000805 Sequence: MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED Predict reactive species\nFull Name: nuclear casein kinase and cyclin-dependent kinase substrate 1\nCalculated Molecular Weight: 243 aa, 27 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC000805\nGene Symbol: NUCKS1\nGene ID (NCBI): 64710\nRRID: AB_906407\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H1E3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868926333097,"sku":"12023-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12023-2-ap","provider":"Iright","version":"1.0","type":"link"}