{"product_id":"proteintech-12064-1-ap","title":"Proteintech, 12064-1-AP, IL-24 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-24 (12064-1-AP) by Proteintech is a Polyclonal antibody targeting IL-24 in IHC, ELISA applications with reactivity to human samples\n12064-1-AP targets IL-24 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein\nPositive IHC detected in: human malignant melanoma tissue, human prostate cancer tissue,  human colon cancer tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL24, also named as MDA-7, MDA7 or ST16, belongs to the IL-10 family. It has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation. The induction of IL24 by oncogenes may support tumor growth at the early stages of cancer.  The observed molecular weight of IL24 is reported between 25 and 35 kDa, a value higher than the deduced molecular weight of 23 kDa. This difference is likely due to post-translational modifications, such as glycosylation of the endogenously produced molecule.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2701 Product name: Recombinant human IL-24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC009681 Sequence: MNFQQRLQSLWTLASRPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL Predict reactive species\nFull Name: interleukin 24\nCalculated Molecular Weight: 207 aa, 24 kDa\nGenBank Accession Number: BC009681\nGene Symbol: IL-24\nGene ID (NCBI): 11009\nRRID: AB_10640304\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13007\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869001076905,"sku":"12064-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12064-1-ap","provider":"Iright","version":"1.0","type":"link"}