{"product_id":"proteintech-12077-1-ap","title":"Proteintech, 12077-1-AP, TINAGL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TINAGL1 (12077-1-AP) by Proteintech is a Polyclonal antibody targeting TINAGL1 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n12077-1-AP targets TINAGL1 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, human adrenal gland tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1500\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTubulointerstitial nephritis antigen-like 1 (Tinagl1), a secreted extracellular protein, was initially identified as a putative component of the ECM. Tinagl1 is most commonly associated with embryonic development, including the heart and adrenal glands. Low levels of Tinagl1 expression can be dire for craniofacial development and for female fertility.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2721 Product name: Recombinant human TINAGL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC009048 Sequence: MTPVLSPQNLLSCDTHQQQGCRGGRLDGAWWFLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSNDKEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKYWTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH Predict reactive species\nFull Name: tubulointerstitial nephritis antigen-like 1\nCalculated Molecular Weight: 467 aa, 52 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC009048\nGene Symbol: TINAGL1\nGene ID (NCBI): 64129\nRRID: AB_2058942\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZM7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868937474217,"sku":"12077-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12077-1-ap","provider":"Iright","version":"1.0","type":"link"}