{"product_id":"proteintech-12092-1-ap","title":"Proteintech, 12092-1-AP, FKBP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FKBP7 (12092-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP7 in WB, IHC, ELISA applications with reactivity to human samples\n12092-1-AP targets FKBP7 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human lung tissue,  human heart tissue\nPositive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFKBP7(FK506-binding protein 7) is also named as FKBP23 and belongs to immunophilin class of proteins family. This protein contains an N-terminal hydrophobic signal sequence, a PPIase motif, 2 EF-hand domains, and 2 putative N-glycosylation sites. The calculated molecular mass is about 25 kD, but becomes 33 kD following cleavage of the signal sequence(PMID:9806833). It could bind to BiP in ER in a process regulated by the concentration of Ca2+(PMID:22269648). It has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2733 Product name: Recombinant human FKBP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC009711 Sequence: MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL Predict reactive species\nFull Name: FK506 binding protein 7\nCalculated Molecular Weight: 259 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC009711\nGene Symbol: FKBP7\nGene ID (NCBI): 51661\nRRID: AB_2103418\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y680\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887641252009,"sku":"12092-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12092-1-ap","provider":"Iright","version":"1.0","type":"link"}