{"product_id":"proteintech-12129-1-ap","title":"Proteintech, 12129-1-AP, SNAI2\/SLUG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNAI2\/SLUG (12129-1-AP) by Proteintech is a Polyclonal antibody targeting SNAI2\/SLUG in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n12129-1-AP targets SNAI2\/SLUG in WB, IHC, IF, FC (Intra), CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, mouse brain tissue,  rat heart tissue,  mouse spleen tissue\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSNAI2 belongs to the Snail family of zinc finger transcription factors, which shares an evolutionarily conserved role in mesoderm formation in vertebrates and invertebrates. It tiggers epithelial-mesenchymal transitions and has a crucial role in developmental processes. Also it is a transcriptional reperssor in mediating RAF-induced expression of TJ protein, occludin(OCLN) and subsequent oncogenic transformation of epithelial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2773 Product name: Recombinant human SNAI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-268 aa of BC015895 Sequence: MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH Predict reactive species\nFull Name: snail homolog 2 (Drosophila)\nCalculated Molecular Weight: 268 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC015895\nGene Symbol: SLUG\nGene ID (NCBI): 6591\nRRID: AB_2191889\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43623\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868823736489,"sku":"12129-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12129-1-ap","provider":"Iright","version":"1.0","type":"link"}