{"product_id":"proteintech-12138-1-ap","title":"Proteintech, 12138-1-AP, LSM6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LSM6 (12138-1-AP) by Proteintech is a Polyclonal antibody targeting LSM6 in IHC, ELISA applications with reactivity to human samples\n12138-1-AP targets LSM6 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLSM6 plays role in pre-mRNA splicing as component of the U4\/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex) (PMID: 28781166). LSM6 is a component of LSm protein complexes, and LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA (PMID: 10523320).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2784 Product name: Recombinant human LSM6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC016026 Sequence: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM Predict reactive species\nFull Name: LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)\nCalculated Molecular Weight: 80 aa, 9 kDa\nGenBank Accession Number: BC016026\nGene Symbol: LSM6\nGene ID (NCBI): 11157\nRRID: AB_2616314\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62312\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887709376681,"sku":"12138-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12138-1-ap","provider":"Iright","version":"1.0","type":"link"}