{"product_id":"proteintech-12160-1-ap","title":"Proteintech, 12160-1-AP, PAR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAR2 (12160-1-AP) by Proteintech is a Polyclonal antibody targeting PAR2 in WB, ELISA applications with reactivity to human samples\n12160-1-AP targets PAR2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, DU 145 cells,  LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProteinase-activated receptors (PARs) are G protein-coupled receptors activated through cleavage of their N-termini by mainly serine proteases. The family of PARs includes four members: PAR1, PAR2, PAR3, and PAR4. PAR2, also known as F2RL1, is expressed in epithelial cells (e.g., lung, gastrointestinal tract), endothelial cells, smooth muscle cells, fibroblasts, nerves, and some immune and inflammatory cells. PAR2 knockout mice and PAR2 agonists and antagonists have implicated PAR2 as a promising target in inflammatory conditions; respiratory, gastrointestinal, metabolic, cardiovascular, and neurological dysfunction; and cancers. (PMID:23895492)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2801 Product name: Recombinant human F2RL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-87 aa of BC018130 Sequence: LLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFV Predict reactive species\nFull Name: coagulation factor II (thrombin) receptor-like 1\nCalculated Molecular Weight: 397 aa, 44 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC018130\nGene Symbol: PAR2\nGene ID (NCBI): 2150\nRRID: AB_10598009\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55085\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868935475369,"sku":"12160-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12160-1-ap","provider":"Iright","version":"1.0","type":"link"}