{"product_id":"proteintech-12176-1-ap","title":"Proteintech, 12176-1-AP, FAM107A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM107A (12176-1-AP) by Proteintech is a Polyclonal antibody targeting FAM107A in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n12176-1-AP targets FAM107A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM107A, also named as TU3A, encodes a 144 amino-acid protein, which contains a coiled-coil domain and a nuclear localization signal. FAM107A as a transcription factor regulates some gene transcription and signal transduction in cell. With the exception of peripheral blood cells, FAM107A is widely expressed in normal tissues, but shows significant loss of expression in renal cell carcinomas and frequent loss of expression in cervical, gastric, ovarian and non small cell lung cancers. Transfection of FAM107A mRNA into cancer cell line inhibits cell growth and proliferation, supporting the evidence that the gene functions as an important tumor suppressor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2820 Product name: Recombinant human FAM107A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC010561 Sequence: MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL Predict reactive species\nFull Name: family with sequence similarity 107, member A\nCalculated Molecular Weight: 144 aa, 17 kDa\nGenBank Accession Number: BC010561\nGene Symbol: FAM107A\nGene ID (NCBI): 11170\nRRID: AB_2877832\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95990\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868997669033,"sku":"12176-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12176-1-ap","provider":"Iright","version":"1.0","type":"link"}