{"product_id":"proteintech-12231-1-ap","title":"Proteintech, 12231-1-AP, CD73 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD73 (12231-1-AP) by Proteintech is a Polyclonal antibody targeting CD73 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n12231-1-AP targets CD73 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, human spleen tissue,  K-562 cells,  mouse brain tissue,  HT-29 cells,  HuH-7 cells,  Jurkat cells\nPositive IHC detected in: human lung cancer tissue, human stomach cancer tissue,  human stomach tissue,  mouse kidney tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse small intestine tissue, human appendicitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNT5E(5'-nucleotidase) is also named as NT5, NTE,CD73,ecto-5'-nucleotidase, and belongs to the 5'-nucleotidase family. It catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP.The enzyme occurs mainly as a dimer and the wide distribution of NT5E in the rat hippocampus, suggesting their involvement in the control of the purinergic signaling(PMID:17619139). This protein has two isoforms with the molecular weight of 63 kDa and 58 kDa and four glycosylation sites with a signalpeptide. It can exsit as a dimer(PMID:17619139). It can be detected the band of 55 kDa, 64 kDa, 70 kDa, 110 kDa by western blot(PMID:17619139; 12370277; 21533188). Defects in NT5E are the cause of calcification of joints and arteries (CALJA).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2869 Product name: Recombinant human NT5E,CD73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-264 aa of BC015940 Sequence: LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR Predict reactive species\nFull Name: 5'-nucleotidase, ecto (CD73)\nCalculated Molecular Weight: 29 kDa, 63 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC015940\nGene Symbol: CD73\nGene ID (NCBI): 4907\nRRID: AB_2154081\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21589\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868836941993,"sku":"12231-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12231-1-ap","provider":"Iright","version":"1.0","type":"link"}