{"product_id":"proteintech-12244-1-ap","title":"Proteintech, 12244-1-AP, NELF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NELF (12244-1-AP) by Proteintech is a Polyclonal antibody targeting NELF in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12244-1-AP targets NELF in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  human brain tissue,  human colon tissue,  mouse testis tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNSMF, also named as NELF (Nasal embryonic LHRH factor), couples NMDA-sensitive glutamate receptor signaling to the nucleus and triggers long-lasting changes in the cytoarchitecture of dendrites and spine synapse processes. NSMF has some isoforms with MW 44 kDa and 55-60 kDa. This antibody recognizes all the isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2888 Product name: Recombinant human NELF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC016862 Sequence: ERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKGLEAVACDTEGFVPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIERKLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL Predict reactive species\nFull Name: nasal embryonic LHRH factor\nCalculated Molecular Weight: 507 aa, 56 kDa\nObserved Molecular Weight: 54-60 kDa\nGenBank Accession Number: BC016862\nGene Symbol: NELF\nGene ID (NCBI): 26012\nRRID: AB_2150819\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6X4W1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887734804649,"sku":"12244-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12244-1-ap","provider":"Iright","version":"1.0","type":"link"}