{"product_id":"proteintech-12245-1-ap","title":"Proteintech, 12245-1-AP, Cystatin C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cystatin C (12245-1-AP) by Proteintech is a Polyclonal antibody targeting Cystatin C in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n12245-1-AP targets Cystatin C in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, fetal human brain tissue,  HepG2 cells,  human milk,  HeLa cells,  U-87 MG cells,  U2OS cells,  human urine,  human serum,  mouse brain tissue\nPositive IP detected in: Caco-2 cells\nPositive IHC detected in: mouse kidney tissue, human kidney tissue,  human ovary tissue,  human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse kidney tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCystatin C is a 13-kDa inhibitor of cysteine proteinases which is secreted by all cell types and is completely cleared from the organism through glomerular filtration, shown to be an early and sensitive biomarker of renal dysfunction. It is also used as an emerging biomarker in cardiovascular disease. Cystatin C is involved in a variety of inflammatory reactions. The concentration of serum cystatin C has also been shown to be unaltered in certain inflammatory conditions or other disorders of metabolism. The plasma level of serum cystatin C can be expressed as its level of generation from cells and diet and its subsequent elimination through the gut, liver, and kidneys.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, duck\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2890 Product name: Recombinant human Cystatin C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-146 aa of BC013083 Sequence: AGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Predict reactive species\nFull Name: cystatin C\nCalculated Molecular Weight: 146 aa, 16 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC013083\nGene Symbol: Cystatin C\nGene ID (NCBI): 1471\nRRID: AB_2088058\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01034\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868851458217,"sku":"12245-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12245-1-ap","provider":"Iright","version":"1.0","type":"link"}