{"product_id":"proteintech-12255-1-ap","title":"Proteintech, 12255-1-AP, RCAS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RCAS1 (12255-1-AP) by Proteintech is a Polyclonal antibody targeting RCAS1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12255-1-AP targets RCAS1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse heart tissue,  rat heart tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEstrogen receptor-binding fragment-associated antigen 9 (EBAG9) gene was identified as an estrogen-responsive gene. The gene product, receptor-binding cancer antigen expressed on SiSo cells (RCAS1), is associated with aggressive characteristics and poor overall survival for 15 different human malignancies. The correlation between RCAS1 expression and several clinicopathological variables, including tumor size, clinical stage, invasion depth and lymph node metastasis highlights this molecule's clinical significance. Expression of RCAS1 in tumor cells plays an important role in evasion from host immune system resulting tumor progression, invasion and metastasis. Further exploration of RCAS1 biological function will facilitate development of novel therapeutic strategies that target RCAS1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2905 Product name: Recombinant human EBAG9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC017729 Sequence: MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS Predict reactive species\nFull Name: estrogen receptor binding site associated, antigen, 9\nCalculated Molecular Weight: 213 aa, 24 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC017729\nGene Symbol: RCAS1\nGene ID (NCBI): 9166\nRRID: AB_2246420\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00559\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869751070889,"sku":"12255-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12255-1-ap","provider":"Iright","version":"1.0","type":"link"}