{"product_id":"proteintech-12279-1-ap","title":"Proteintech, 12279-1-AP, SEMA4G Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEMA4G (12279-1-AP) by Proteintech is a Polyclonal antibody targeting SEMA4G in WB, ELISA applications with reactivity to human samples\n12279-1-AP targets SEMA4G in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HeLa cells,  SH-SY5Y cells,  SW480 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSemaphorins constitute a large and growing gene family, several members of which are axon guidance molecules. SEMA4G, a novel class IV member of the semaphorin gene family, located on mouse chromosome 19. SEMA4G is expressed early in development in the brain, spinal cord, and several sensory organs as well as specific populations of projection neurons, compatible with the well-established function of semaphorins as axon guidance molecules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2928 Product name: Recombinant human SEMA4G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC020960 Sequence: MGSMSPPSAWPCVLDGPETRQDLCQPPKPCVHSHAHMEECLSAGLQCPHPHLLLVHSCFIPASGLGVPSQLPHPIWSSSPAPCGDLFVKSLGTGQPGEVRLHHSPPLPSCVALVNQPPHSPWSFSRV Predict reactive species\nFull Name: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G\nCalculated Molecular Weight: 91 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC020960\nGene Symbol: SEMA4G\nGene ID (NCBI): 57715\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NTN9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887796277417,"sku":"12279-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12279-1-ap","provider":"Iright","version":"1.0","type":"link"}