{"product_id":"proteintech-12287-1-ap","title":"Proteintech, 12287-1-AP, CIDEC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CIDEC (12287-1-AP) by Proteintech is a Polyclonal antibody targeting CIDEC in WB, ELISA applications with reactivity to human samples\n12287-1-AP targets CIDEC in WB, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCell death-inducing DFF45-like effector (CIDE) proteins, including CIDEA, CIDEB and CIDEC (also called Fsp27 in rodents), are predominantly expressed in brown adipose tissues (BAT), liver and WAT. CIDEC was found to be highly expressed in adipose tissues and to function as a lipid droplet-binding protein that promotes lipid accumulation in adipocytes. While normal mouse livers express low levels of CIDEC protein, its expression is highly upregulated in NALFD, but not in chronic ethanol feeding-induced fatty liver. (PMID: 26099526) Catalog#12287-1-AP recognizing CIDEC (calculated 28 kDa) as a 30 kDa and 45-50 kDa due to its posttranslational modification (PMID: 19258494).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2913 Product name: Recombinant human CIDEC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC016851 Sequence: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ Predict reactive species\nFull Name: cell death-inducing DFFA-like effector c\nCalculated Molecular Weight: 238 aa, 27 kDa\nObserved Molecular Weight: 27-35 kDa\nGenBank Accession Number: BC016851\nGene Symbol: CIDEC\nGene ID (NCBI): 63924\nRRID: AB_2877842\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96AQ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939669673,"sku":"12287-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12287-1-ap","provider":"Iright","version":"1.0","type":"link"}