{"product_id":"proteintech-12293-1-ap","title":"Proteintech, 12293-1-AP, TSPAN6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPAN6 (12293-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN6 in WB, ELISA applications with reactivity to human, mouse, rat samples\n12293-1-AP targets TSPAN6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, rat colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPAN6 (also known as TM4SF6) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN6 gene is widely expressed, with high mRNA levels in liver, pancreas, kidney, and ovary (PMID: 9782095). TSPAN6 has been reported as a negative regulator of the RLR pathway by interacting with MAVS in a ubiquitination-dependent manner (PMID: 22908223).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2964 Product name: Recombinant human TSPAN6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-245 aa of BC012389 Sequence: MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNNQYEIV Predict reactive species\nFull Name: tetraspanin 6\nCalculated Molecular Weight: 245 aa, 28 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC012389\nGene Symbol: TSPAN6\nGene ID (NCBI): 7105\nRRID: AB_2213446\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43657\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869624029353,"sku":"12293-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12293-1-ap","provider":"Iright","version":"1.0","type":"link"}