{"product_id":"proteintech-12295-1-ap","title":"Proteintech, 12295-1-AP, Prohibitin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Prohibitin 2 (12295-1-AP) by Proteintech is a Polyclonal antibody targeting Prohibitin 2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n12295-1-AP targets Prohibitin 2 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA, Electrochemical Immunosensor applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IP detected in: HeLa cells,  mouse brain tissue\nPositive IHC detected in: human heart tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHB2, also named as BAP, REA, D-prohibitin, BAP37 and Prohibitin-2, belongs to the prohibitin family. It acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. PHB2 functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. It competes with NCOA1 for modulation of ER transcriptional activity. PHB2 is probably involved in regulating mitochondrial respiration activity and in aging.(PMID: 10359819)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, rice\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2977 Product name: Recombinant human PHB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC014766 Sequence: MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK Predict reactive species\nFull Name: prohibitin 2\nCalculated Molecular Weight: 299 aa, 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC014766\nGene Symbol: Prohibitin 2\nGene ID (NCBI): 11331\nRRID: AB_2164779\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99623\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839039145,"sku":"12295-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12295-1-ap","provider":"Iright","version":"1.0","type":"link"}