{"product_id":"proteintech-12340-1-ap","title":"Proteintech, 12340-1-AP, RALB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RALB (12340-1-AP) by Proteintech is a Polyclonal antibody targeting RALB in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n12340-1-AP targets RALB in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells,  human brain tissue,  human lung tissue,  mouse brain tissue,  mouse lung tissue\nPositive IHC detected in: human ovary tumor tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, drosophila\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2992 Product name: Recombinant human RALB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC018163 Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL Predict reactive species\nFull Name: v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)\nCalculated Molecular Weight: 206 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC018163\nGene Symbol: RALB\nGene ID (NCBI): 5899\nRRID: AB_2269253\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11234\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869426372777,"sku":"12340-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12340-1-ap","provider":"Iright","version":"1.0","type":"link"}