{"product_id":"proteintech-12353-1-ap","title":"Proteintech, 12353-1-AP, TAF12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAF12 (12353-1-AP) by Proteintech is a Polyclonal antibody targeting TAF12 in WB, IP, ELISA applications with reactivity to human,  mouse samples\n12353-1-AP targets TAF12 in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells\nPositive IP detected in: Y79 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAF12, also named TAF15 or TAF2J, is a TBP-associated factor that is contained in Pol I- and Pol II-specific TBP-TAF complexes, it is also a component of the transcription factor IID (TFIID) complex, which is essential for mediating regulation of RNA polymerase transcription. TAF12 plays a key role in regulating eukaryotic gene expression by directly binding promoters and enhancer-bound transactivator proteins. Likewise, TAF12 recruits Gadd45a and the nucleotide excision repair complex to the promoter of rRNA genes leading to active DNA demethylation. Observed MW of TAF12 is from 14-17 kDa and 17-21 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3017 Product name: Recombinant human TAF12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-161 aa of BC011986 Sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK Predict reactive species\nFull Name: TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC011986\nGene Symbol: TAF12\nGene ID (NCBI): 6883\nRRID: AB_2271582\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16514\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868945666217,"sku":"12353-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12353-1-ap","provider":"Iright","version":"1.0","type":"link"}