{"product_id":"proteintech-12355-1-ap","title":"Proteintech, 12355-1-AP, ESM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ESM1 (12355-1-AP) by Proteintech is a Polyclonal antibody targeting ESM1 in WB, IP, ELISA applications with reactivity to human samples\n12355-1-AP targets ESM1 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells\nPositive IP detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nESM1 is a secreted protein mainly expressed in the endothelial cells. The deduced 184-amino acid protein is cysteine rich with an N-terminal hydrophobic signal sequence. Expression of ESM1 was tested by Northern blot analysis and RT-PCR and was found to be constitutive in a HUVEC cell line, but not in any other cell line tested. Constitutive ESM1 expression in human tissue was restricted to lung.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3019 Product name: Recombinant human ESM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-184 aa of BC011989 Sequence: SNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR Predict reactive species\nFull Name: endothelial cell-specific molecule 1\nCalculated Molecular Weight: 184 aa, 20 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC011989\nGene Symbol: ESM1\nGene ID (NCBI): 11082\nRRID: AB_3669137\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQ30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887627948201,"sku":"12355-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12355-1-ap","provider":"Iright","version":"1.0","type":"link"}