{"product_id":"proteintech-12358-1-ap","title":"Proteintech, 12358-1-AP, NDUFB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFB3 (12358-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12358-1-AP targets NDUFB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: human liver cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFB3(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3) is also named as CI-B12 and belongs to the complex I NDUFB3 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3022 Product name: Recombinant human NDUFB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC018183 Sequence: MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa\nCalculated Molecular Weight: 98 aa, 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC018183\nGene Symbol: NDUFB3\nGene ID (NCBI): 4709\nRRID: AB_2282633\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43676\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869717057705,"sku":"12358-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12358-1-ap","provider":"Iright","version":"1.0","type":"link"}