{"product_id":"proteintech-12359-1-ap","title":"Proteintech, 12359-1-AP, SYTL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYTL2 (12359-1-AP) by Proteintech is a Polyclonal antibody targeting SYTL2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12359-1-AP targets SYTL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Jurkat cells,  MCF-7 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSynaptotagmin-like 2 (SYTL2) is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. SYTL2 contains an N-terminal Slp homology domain (SHD), Rab-binding region, and C-terminal tandem C2 domains, C2A and C2B (PMID: 11327731). It interacts with RAB27A and plays a role in promoting docking of RAB27-bound organelles to the plasma membrane (PMID: 17052176). Alternative splicing of SYTL2 gene results in multiple transcript variants encoding distinct isoforms with calculated molecular weights ranging from 39 kDa to 142 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3023 Product name: Recombinant human SYTL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-382 aa of BC015540 Sequence: MSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKGNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKMVNSPNTWIEATLPLRMLLIAKISK Predict reactive species\nFull Name: synaptotagmin-like 2\nCalculated Molecular Weight: 934 aa, 105 kDa\nObserved Molecular Weight: 39 kDa, 100-105 kDa\nGenBank Accession Number: BC015540\nGene Symbol: SYTL2\nGene ID (NCBI): 54843\nRRID: AB_11182492\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HCH5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869610561705,"sku":"12359-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12359-1-ap","provider":"Iright","version":"1.0","type":"link"}