{"product_id":"proteintech-12368-1-ap","title":"Proteintech, 12368-1-AP, PINX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PINX1 (12368-1-AP) by Proteintech is a Polyclonal antibody targeting PINX1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12368-1-AP targets PINX1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, A431 cells,  C6 cells,  NIH\/3T3 cells,  HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPINX1, also named as LPTL, LPTS and Protein 67-11-3, is a Liver-related putative tumor suppressor. It belongs to the PINX1 family. PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. It mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. PINX1 inhibits telomerase activity. It may inhibit cell proliferation and act as tumor suppressor. PINX1 has been identified as a critical telomerase inhibitor and proposed to be a putative tumor suppressor gene. Loss of PinX1 has been found in a large variety of malignancies, but the expression status in epithelial ovarian tumors has not been investigated.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3043 Product name: Recombinant human PINX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-328 aa of BC015479 Sequence: MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKINKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK Predict reactive species\nFull Name: PIN2-interacting protein 1\nCalculated Molecular Weight: 328 aa, 37 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC015479\nGene Symbol: PINX1\nGene ID (NCBI): 54984\nRRID: AB_2164405\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96BK5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868935835817,"sku":"12368-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12368-1-ap","provider":"Iright","version":"1.0","type":"link"}