{"product_id":"proteintech-12375-1-ap","title":"Proteintech, 12375-1-AP, COX2\/ Cyclooxygenase 2\/ PTGS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX2\/ Cyclooxygenase 2\/ PTGS2 (12375-1-AP) by Proteintech is a Polyclonal antibody targeting COX2\/ Cyclooxygenase 2\/ PTGS2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n12375-1-AP targets COX2\/ Cyclooxygenase 2\/ PTGS2 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, RAW 264.7 cells,  HeLa cells,  NIH\/3T3 cells,  HEK-293 cells,  Raji cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX2 is an enzyme involved in the synthesis of prostaglandins from arachidonic acid.1.What is the molecular weight of COX2?The fully N-glycosylated PTGS2 is 72-74 kDa and the aglycosylated is 66 kDa (PMID:19656660). It alsoexpresses a band of 39 kDa after unspecific cleavage (PMID:17509125). The 50 kDa band of fragmentedPTGS2 has also previously been detected in AD brains (PMID:14724276).2.Is COX2 post-translationally modified?COX2 is a subject of post-translational modifications, including phosphorylation, glycosylation, ands-nitrosylation (PMID: 28939645).3.What is the difference between COX1, COX2, and COX3?There are three isoenzymes that have cyclooxygenase activity: COX1, COX2, and COX3. While COX1is a ubiquitously expressed constitutive enzyme, expression of COX2 is generally low but can be rapidlyinduced by various stimuli (as part of infection and inflammatory response) and is controlled by thetranscription factor NFκB. COX3 is an alternative splice variant of COX1 enzyme and is considerednon-functional in humans.4.I cannot detect COX2 in my sample during western blotting.Unlike COX1, COX2 expression is inducible by a variety of stimuli including certain growth factors,cytokines,and proinflammatory stimuli. COX2 basal expression levels may be very low in unstimulatedcells. Additionally,the COX2 half-life time is short and after stimulation, COX2 protein can be quicklydegraded to basal levels(PMID: 10966456), which should be taken into account during experimental design.5.What is the role of COX2 in cancer?COX2 is often upregulated in various cancer types and increased expression of COX2 is associatedwithgreater angiogenesis of solid tumors, increased invasion, and metastasis, as well as decreasedhost immunity.6.What is subcellular localization of COX2?Both COX1 and COX2 are present in the endoplasmic reticulum (ER) and nuclear envelope(PMID: 9545330),but COX2 has been reported to be more enriched in the nuclear envelopecompared to COX1 (PMID: 7738031).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3025 Product name: Recombinant human COX2\/ Cyclooxygenase 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-366 aa of BC013734 Sequence: PCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAE Predict reactive species\nFull Name: prostaglandin-endoperoxide synthase 2 (prostaglandin G\/H synthase and cyclooxygenase)\nCalculated Molecular Weight: 604 aa, 68 kDa\nObserved Molecular Weight: 70-74 kDa\nGenBank Accession Number: BC013734\nGene Symbol: COX2\/PTGS2\nGene ID (NCBI): 5743\nRRID: AB_2085127\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35354\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868816625833,"sku":"12375-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12375-1-ap","provider":"Iright","version":"1.0","type":"link"}