{"product_id":"proteintech-12376-1-ap","title":"Proteintech, 12376-1-AP, TALDO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TALDO1 (12376-1-AP) by Proteintech is a Polyclonal antibody targeting TALDO1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n12376-1-AP targets TALDO1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  COLO 320 cells,  HepG2 cells\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human colon tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTALDO1 belongs to the transaldolase family which contributes to the generation of NADPH in the nonoxidative phase of the pentose phosphate pathway (PPP). Defects in TALDO1 are the cause of transaldolase 1 deficiency which results in telangiectases of the skin, hepatosplenomegaly, and enlarged clitoris.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3031 Product name: Recombinant human TALDO1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-277 aa of BC009680 Sequence: MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAK Predict reactive species\nFull Name: transaldolase 1\nCalculated Molecular Weight: 337 aa, 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC009680\nGene Symbol: TALDO1\nGene ID (NCBI): 6888\nRRID: AB_2199712\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P37837\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868974272681,"sku":"12376-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12376-1-ap","provider":"Iright","version":"1.0","type":"link"}