{"product_id":"proteintech-12412-1-ap","title":"Proteintech, 12412-1-AP, GSTM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSTM1 (12412-1-AP) by Proteintech is a Polyclonal antibody targeting GSTM1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12412-1-AP targets GSTM1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, HeLa cells,  mouse kidney tissue,  mouse ovary tissue,  rat liver tissue\nPositive IHC detected in: mouse liver tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGSTM1 belongs to the superfamily of glutathione-Stransferases (GSTs) of phase 2 enzymes that catalyze a number of distinct glutathione-dependent reactions. GSTM1 gene has been a natural candidate in studies of susceptibility to inflammatory airway diseases with environmental components because of the high prevalence of the null polymorphism and its role in detoxification (PMID: 22683820).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3113 Product name: Recombinant human GSTM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC024005 Sequence: MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK Predict reactive species\nFull Name: glutathione S-transferase mu 1\nCalculated Molecular Weight: 181 aa, 21 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC024005\nGene Symbol: GSTM1\nGene ID (NCBI): 2944\nRRID: AB_2115925\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09488\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868864663721,"sku":"12412-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12412-1-ap","provider":"Iright","version":"1.0","type":"link"}