{"product_id":"proteintech-12419-1-ap","title":"Proteintech, 12419-1-AP, EDF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EDF1 (12419-1-AP) by Proteintech is a Polyclonal antibody targeting EDF1 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n12419-1-AP targets EDF1 in WB, IHC, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, A549 cells,  mouse pancreas tissue\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3063 Product name: Recombinant human EDF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC015500 Sequence: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK Predict reactive species\nFull Name: endothelial differentiation-related factor 1\nCalculated Molecular Weight: 148 aa, 16 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC015500\nGene Symbol: EDF1\nGene ID (NCBI): 8721\nRRID: AB_2230895\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60869\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869404156073,"sku":"12419-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12419-1-ap","provider":"Iright","version":"1.0","type":"link"}