{"product_id":"proteintech-12450-1-ap","title":"Proteintech, 12450-1-AP, TCEB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TCEB1 (12450-1-AP) by Proteintech is a Polyclonal antibody targeting TCEB1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12450-1-AP targets TCEB1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human breast cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTCEB1, also named as RNA polymerase II transcription factor SIII subunit C, belongs to the SKP1 family. It mediates the ubiquitination of ECS-E3 ubiquitin-protein ligase complexes. TCEB1 is overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. TCEB1 also promotes invasion of prostate cancer cells (PMID:18844214).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3087 Product name: Recombinant human TCEB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC013809 Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC Predict reactive species\nFull Name: transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)\nCalculated Molecular Weight: 112 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC013809\nGene Symbol: TCEB1\nGene ID (NCBI): 6921\nRRID: AB_2201139\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15369\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868974370985,"sku":"12450-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12450-1-ap","provider":"Iright","version":"1.0","type":"link"}