{"product_id":"proteintech-12456-1-ap","title":"Proteintech, 12456-1-AP, PDCD5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDCD5 (12456-1-AP) by Proteintech is a Polyclonal antibody targeting PDCD5 in WB, IHC, ELISA applications with reactivity to human samples\n12456-1-AP targets PDCD5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, PC-3 cells,  human brain tissue,  A549 cells\nPositive IHC detected in: human endometrial cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDCD5, also called TFAR19 (TF1 cell apoptosis-related gene 19), was first identified as a gene up-regulated in TF-1 cells under-going apoptosis (PMID: 9920759). PDCD5 can promote pro-grammed cell death in different cell types in response to various stimuli and also enhance TAJ\/TROY-induced paraptosis-like cell death (PMID: 15020679). During apoptosis, PDCD5 is rapidly upregulated and translocates from the cytoplasm to nucleus (PMID: 11741587). PDCD5 is a positive regulator of Tip60 and also has a potential ability to interact with p53 (PMID: 22914926, PMID: 19308289). Recent studies have also revealed that PDCD5 may be a suppressor gene and expressed at lower levels in many cancers, including hepatocellular carcinoma, breast cancer, gastric cancer, cervical cancer, lung cancer, astrocytic gliomas, and in leukemia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3122 Product name: Recombinant human PDCD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC015519 Sequence: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY Predict reactive species\nFull Name: programmed cell death 5\nCalculated Molecular Weight: 125 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC015519\nGene Symbol: PDCD5\nGene ID (NCBI): 9141\nRRID: AB_2162450\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14737\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868898545833,"sku":"12456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12456-1-ap","provider":"Iright","version":"1.0","type":"link"}