{"product_id":"proteintech-12517-1-ap","title":"Proteintech, 12517-1-AP, GLIPR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLIPR1 (12517-1-AP) by Proteintech is a Polyclonal antibody targeting GLIPR1 in WB, ELISA applications with reactivity to human, rat, pig samples\n12517-1-AP targets GLIPR1 in WB, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  rat kidney tissue,  pig kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLIPR1, also known as related to testis-specific, vespid, and pathogenesis protein 1 (RTVP-1), is a membrane protein that belongs to the CAP family of cysteine-rich secretory proteins. GLIPR1 is closely associated with the development of tumors, especially GM (8,9). The high expression of GLIPR1 was found in GM cells but not in tumors or other cells of the central nervous system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3205 Product name: Recombinant human GLIPR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-240 aa of BC012510 Sequence: SNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIV Predict reactive species\nFull Name: GLI pathogenesis-related 1\nCalculated Molecular Weight: 266 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC012510\nGene Symbol: GLIPR1\nGene ID (NCBI): 11010\nRRID: AB_3669144\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48060\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887651868841,"sku":"12517-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12517-1-ap","provider":"Iright","version":"1.0","type":"link"}