{"product_id":"proteintech-12527-1-ap","title":"Proteintech, 12527-1-AP, CHMP2B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHMP2B (12527-1-AP) by Proteintech is a Polyclonal antibody targeting CHMP2B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12527-1-AP targets CHMP2B in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, human heart tissue,  mouse brain tissue,  human ileum tissue,  human kidney tissue,  human placenta tissue,  human brain tissue\nPositive IHC detected in: mouse brain tissue, human brain tissue,  human liver cancer tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, PFA fixed cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHMP2B, chromatin-modifying protein 2b, also named CHMP2.5, VPS2B, and VPS2 2, belongs to the chromatin-modifying protein \/ charged multivesicular body protein (CHMP) family. It is a component of the endosomal sorting complex required for transport III (ESCRT-III), which involves in endosomal and autophagic trafficking of proteins to lysosomes for degradation. Mutations of CHMP2B lead to C-terminal truncation or are replaced with mis-splicing C-termini and cause frontotemporal lobar degeneration (FTLD). In CHMP2B mutation patients, p62- and ubiquitin-positive, but TDP-43 and FUS negative neural inclusions are formed, which may be caused by impaired lysosomal degradation through the autophagy and endosome-lysosome pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3222 Product name: Recombinant human CHMP2B protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-213 aa of BC001553 Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD Predict reactive species\nFull Name: chromatin modifying protein 2B\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC001553\nGene Symbol: CHMP2B\nGene ID (NCBI): 25978\nRRID: AB_10603358\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQN3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868881309865,"sku":"12527-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12527-1-ap","provider":"Iright","version":"1.0","type":"link"}