{"product_id":"proteintech-12532-1-ap","title":"Proteintech, 12532-1-AP, GAGE2D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GAGE2D (12532-1-AP) by Proteintech is a Polyclonal antibody targeting GAGE2D in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n12532-1-AP targets GAGE2D in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  HeLa cells,  human testis tissue\nPositive IHC detected in: human liver cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGAGE2D, also named as GAGE8 and CT4.8, is expressed in testis and tumor tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3230 Product name: Recombinant human GAGE2D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC018052 Sequence: MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC Predict reactive species\nFull Name: G antigen 2D\nCalculated Molecular Weight: 116 aa, 13 kDa\nObserved Molecular Weight: 18-22 kDa\nGenBank Accession Number: BC018052\nGene Symbol: GAGE2D\nGene ID (NCBI): 729408\nRRID: AB_2877864\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UEU5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887645970601,"sku":"12532-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12532-1-ap","provider":"Iright","version":"1.0","type":"link"}