{"product_id":"proteintech-12538-1-ap","title":"Proteintech, 12538-1-AP, PPIL4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPIL4 (12538-1-AP) by Proteintech is a Polyclonal antibody targeting PPIL4 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12538-1-AP targets PPIL4 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HCT 116 cells,  mouse kidney tissue,  HeLa cells,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeptidyl-prolyl isomerase (PPIase) catalyzes the interconversion of a specific Pro-imide bond between the cis and trans conformations. PPIL4 belongs to the cyclophilin subgroup of the peptidyl-prolyl cis-trans isomerase (PPIase) protein family (PPIs). It contains an RNA recognition motif and a PPIase-like domain. PPIL4, as an IA susceptibility gene, is a novel and key regulatory molecule in Wnt signaling and vertebrate cerebrovascular development (PMID: 34887573).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3249 Product name: Recombinant human PPIL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-492 aa of BC016984 Sequence: MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLVLKDKVKPKQDTKYDLILDEQAEDSKSSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSPKKSKDKEKSKYR Predict reactive species\nFull Name: peptidylprolyl isomerase (cyclophilin)-like 4\nCalculated Molecular Weight: 492 aa, 57 kDa\nObserved Molecular Weight: 58-65 kDa\nGenBank Accession Number: BC016984\nGene Symbol: PPIL4\nGene ID (NCBI): 85313\nRRID: AB_10644441\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WUA2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869734031529,"sku":"12538-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12538-1-ap","provider":"Iright","version":"1.0","type":"link"}