{"product_id":"proteintech-12569-1-ap","title":"Proteintech, 12569-1-AP, SCFD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCFD1 (12569-1-AP) by Proteintech is a Polyclonal antibody targeting SCFD1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12569-1-AP targets SCFD1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293T cells,  human kidney tissue,  human liver tissue,  HEK-293 cells,  HeLa cells,  NIH\/3T3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCFD1, also named as C14orf163, KIAA0917, STXBP1L2, Sly1p and SLY1, belongs to the STXBP\/unc-18\/SEC1 family. It is a component of the syntaxin-5 SNARE complex which  regulates the early secretory pathway of eukaryotic cells at the level of endoplasmic reticulum (ER) to Golgi transport.(PMID:21242315) SCFD1 plays a role in SNARE-pin assembly and Golgi-to-ER retrograde transport via its interaction with COG4. It is involved in vesicular transport between the endoplasmic reticulum and the Golgi.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, bacteria\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3234 Product name: Recombinant human SCFD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 342-642 aa of BC017734 Sequence: QQELESYRAQEDEVKRLKSIMGLEGEDEGAISMLSDNTAKLTSAVSSLPELLEKKRLIDLHTNVATAVLEHIKARKLDVYFEYEEKIMSKTTLDKSLLDIISDPDAGTPEDKMRLFLIYYISTQQAPSEADLEQYKKALTDAGCNLNPLQYIKQWKAFTKMASAPASYGSTTTKPMGLLSRVMNTGSQFVMEGVKNLVLKQQNLPVTRILDNLMEMKSNPETDDYRYFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGKHILYGCSELFNATQFIKQLSQLGQK Predict reactive species\nFull Name: sec1 family domain containing 1\nCalculated Molecular Weight: 642 aa, 72 kDa\nObserved Molecular Weight: 66-72 kDa\nGenBank Accession Number: BC017734\nGene Symbol: SCFD1\nGene ID (NCBI): 23256\nRRID: AB_2183266\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WVM8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988526761,"sku":"12569-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12569-1-ap","provider":"Iright","version":"1.0","type":"link"}