{"product_id":"proteintech-12584-1-ap","title":"Proteintech, 12584-1-AP, THAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe THAP1 (12584-1-AP) by Proteintech is a Polyclonal antibody targeting THAP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12584-1-AP targets THAP1 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human brain tissue,  HEK-293 cells,  HeLa cells,  human heart tissue,  A375 cells,  SGC-7901 cells,  mouse brain tissue,  mouse heart tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTHAP1 belongs to the THAP1 family. It is a DNA-binding transcription regulator that regulates endothelial cell proliferation and G1\/S cell-cycle progression. THAP1 may also have pro-apoptopic activity by potentiating both serum-withdrawal and TNF-induced apoptosis. Mutations in THAP1 have been associated with dystonia 6. THAP1 encodes a transcription factor with mostly unknown targets. It regulates the expression of DYT1 (TOR1A), another dystonia-causing gene. After characterization of the TOR1A promoter, THAP1 binds to the core promoter of TOR1A. Wild type THAP1 represses the expression of TOR1A, whereas dystonia 6-associated mutant THAP1 results in decreased repression of TOR1A. Catalog#12584-1-AP is a rabbit polyclonal antibody raised against full-length of huamn THAP1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3285 Product name: Recombinant human THAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC021721 Sequence: MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA Predict reactive species\nFull Name: THAP domain containing, apoptosis associated protein 1\nCalculated Molecular Weight: 213 aa, 25 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC021721\nGene Symbol: THAP1\nGene ID (NCBI): 55145\nRRID: AB_2201672\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NVV9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868914995369,"sku":"12584-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12584-1-ap","provider":"Iright","version":"1.0","type":"link"}