{"product_id":"proteintech-12599-1-ap","title":"Proteintech, 12599-1-AP, CTBS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTBS (12599-1-AP) by Proteintech is a Polyclonal antibody targeting CTBS in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12599-1-AP targets CTBS in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells\nPositive IHC detected in: human prostate cancer tissue, human liver cancer tissue,  human liver tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTBS(Di-N-acetylchitobiase (chitobiase)) also named as CTB, is a lysosomal exoglycosidase that splits the GlcNAcβ-D-(l-4)GlcNAc chitobiose core of asparagine-linked glycoproteins. Chitobiase has been purified from human liver and kidney and rat liver. Both the human and rat enzymes are approximately 40-45 kDa and require a free reducing end GlcNAc for activity(PMID:1527079). This full length protein has a signal peptide and four glycosylation sites.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3228 Product name: Recombinant human CTBS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC024007 Sequence: MSRPQLRRWRLVSSPPSGVPGLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL Predict reactive species\nFull Name: chitobiase, di-N-acetyl-\nCalculated Molecular Weight: 12 kDa, 43 kDa\nObserved Molecular Weight: 44-50 kDa\nGenBank Accession Number: BC024007\nGene Symbol: CTBS\nGene ID (NCBI): 1486\nRRID: AB_10638783\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01459\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886930120873,"sku":"12599-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12599-1-ap","provider":"Iright","version":"1.0","type":"link"}