{"product_id":"proteintech-12611-1-ap","title":"Proteintech, 12611-1-AP, ECOP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ECOP (12611-1-AP) by Proteintech is a Polyclonal antibody targeting ECOP in WB, IHC, ELISA applications with reactivity to human, mouse samples\n12611-1-AP targets ECOP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Transfected HEK-293 cells\nPositive IHC detected in: human kidney tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nECOP, also named as VOPP1 and GASP, has been previously shown to be over-expressed in human glioblastoma multiforme and squamous cell carcinoma. It interacts directly with cytoplasmic mediators of the NF kappa B pathway. ECOP has three isoforms with MW 18-19 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3225 Product name: Recombinant human ECOP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-172 aa of BC016650 Sequence: KKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMGVLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQVPPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK Predict reactive species\nFull Name: EGFR-coamplified and overexpressed protein\nCalculated Molecular Weight: 172 aa, 19 kDa\nGenBank Accession Number: BC016650\nGene Symbol: ECOP\nGene ID (NCBI): 81552\nRRID: AB_2877866\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96AW1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869458124969,"sku":"12611-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12611-1-ap","provider":"Iright","version":"1.0","type":"link"}