{"product_id":"proteintech-12622-1-ap","title":"Proteintech, 12622-1-AP, RFX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RFX2 (12622-1-AP) by Proteintech is a Polyclonal antibody targeting RFX2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12622-1-AP targets RFX2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\nPositive IP detected in: THP-1 cells\nPositive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRFX2 is a key regulator of ciliogenesis in vertebrates, and knockdown of Rfx2 causes defects in neural tube closure and in left-right axis patterning (PMID: 26248850). RFX2 expression is greatly enhanced in adult testis and that RFX2 is equally prominent in highly enriched populations of late pachytene spermatocytes and round spermatids(PMID: 22227339). RFX2 is also required for the development of left-right asymmetry, and motile cilia on RFX2-expressing cells are sufficient to establish adequate fluid flow across the COA to direct normal LR development in mouse (PMID: 22233545).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3310 Product name: Recombinant human RFX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 424-723 aa of BC028579 Sequence: VLPKDKLISLCQCDPILRWMRSCDHILYQALVEILIPDVLRPVPSTLTQAIRNFAKSLEGWLTNAMSDFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCEESVVQRLEQDFKLTLQQQSSLDQWASWLDSVVTQVLKQHAGSPSFPKAAQQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAEATGETPIAVMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI Predict reactive species\nFull Name: regulatory factor X, 2 (influences HLA class II expression)\nCalculated Molecular Weight: 723 aa, 80 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC028579\nGene Symbol: RFX2\nGene ID (NCBI): 5990\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48378\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869752348841,"sku":"12622-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12622-1-ap","provider":"Iright","version":"1.0","type":"link"}