{"product_id":"proteintech-12627-1-ap","title":"Proteintech, 12627-1-AP, SUCLA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUCLA2 (12627-1-AP) by Proteintech is a Polyclonal antibody targeting SUCLA2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12627-1-AP targets SUCLA2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, L02 cells,  SH-SY5Y cells,  HepG2 cells,  PC-3 cells,  mouse brain tissue,  mouse liver tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon cancer tissue, human heart tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSUCLA2, β subunit of succinate-CoA ligase, contributes to energy production in mitochondria through the succinate-CoA ligase enzyme. Succinate-CoA ligase catalyses the reversible conversion of succinyl-CoA and ADP or GDP to succinate and ATP or GTP. SUCLA2 mutations cause global protein succinylation and mitochondrial DNA depletion (PMID: 33230181, PMID: 20301762). Mutations in SUCLA2 are also associated with SUCLA2-related mitochondrial DNA depletion syndrome, leigh syndrome, down syndrome (PMID: 23010432).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3319 Product name: Recombinant human SUCLA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-353 aa of BC027587 Sequence: AQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESPEAIIKEPIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERDKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGAT Predict reactive species\nFull Name: succinate-CoA ligase, ADP-forming, beta subunit\nCalculated Molecular Weight: 463 aa, 50 kDa\nObserved Molecular Weight: 48-50 kDa\nGenBank Accession Number: BC027587\nGene Symbol: SUCLA2\nGene ID (NCBI): 8803\nRRID: AB_2271200\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P2R7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868872528041,"sku":"12627-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12627-1-ap","provider":"Iright","version":"1.0","type":"link"}