{"product_id":"proteintech-12634-1-ap","title":"Proteintech, 12634-1-AP, DIRAS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DIRAS1 (12634-1-AP) by Proteintech is a Polyclonal antibody targeting DIRAS1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n12634-1-AP targets DIRAS1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  human placenta tissue,  MCF-7 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDIRAS1 belongs to the small guanosine triphosphatase (GTPase) Ras superfamily. DIRAS1 is frequently downregulated in human cancers due to DNA copy number loss, loss of heterozygosity (LOH), and hypermethylation of the promoter. The restoration of DIRAS1 has been reported to suppress tumor growth and metastasis in human neural tumors, esophageal cancer, colorectal cancer, and ovarian cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3329 Product name: Recombinant human DIRAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC030660 Sequence: MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM Predict reactive species\nFull Name: DIRAS family, GTP-binding RAS-like 1\nCalculated Molecular Weight: 198 aa, 22 kDa\nObserved Molecular Weight: 22-24 kDa\nGenBank Accession Number: BC030660\nGene Symbol: DIRAS1\nGene ID (NCBI): 148252\nRRID: AB_2292771\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95057\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868996685993,"sku":"12634-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12634-1-ap","provider":"Iright","version":"1.0","type":"link"}