{"product_id":"proteintech-12667-2-ap","title":"Proteintech, 12667-2-AP, HSPA13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSPA13 (12667-2-AP) by Proteintech is a Polyclonal antibody targeting HSPA13 in WB, IHC, IP, ELISA applications with reactivity to human samples\n12667-2-AP targets HSPA13 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  K-562 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSPA13 (Heat shock 70 kDa protein 13), also known as STCH (the stress 70 protein chaperone), is a member of the Hsp70 family of ATPase \"stress\" or \"heat shock\" proteins. Human STCH encodes a 60 kDa protein that is highly enriched in the ER. Recently it has been reported that overexpression of the HSPA13 gene reduces prion disease incubation time in mice.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3349 Product name: Recombinant human HSPA13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-471 aa of BC036370 Sequence: MPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN Predict reactive species\nFull Name: heat shock protein 70kDa family, member 13\nCalculated Molecular Weight: 471 aa, 52 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC036370\nGene Symbol: HSPA13\nGene ID (NCBI): 6782\nRRID: AB_2119204\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48723\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868955758761,"sku":"12667-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12667-2-ap","provider":"Iright","version":"1.0","type":"link"}