{"product_id":"proteintech-12682-1-ap","title":"Proteintech, 12682-1-AP, MUM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MUM1 (12682-1-AP) by Proteintech is a Polyclonal antibody targeting MUM1 in WB, IP, ELISA applications with reactivity to human samples\n12682-1-AP targets MUM1 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  HT-1080 cells\nPositive IP detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMUM1, also named as EXPAND1, is an architectural component of the chromatin, which in response to DNA damage serves as an accessory factor to promote cell survival. It is a 53BP1-associated DNA damage-responsive factor. MUM1\/EXPAND1 is different to another protein IRF4\/MUM1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3371 Product name: Recombinant human MUM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC008098 Sequence: MLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRWLQTFLSSSQYVTCVETYLEDEGQLDLVVKYLQGVYQEVGAKVLQRTNGDRIRFILDVLLPEAIICAISAVDEVDYKTAEEKYIKGPSLSYREKEIFDNQLLEERNRRRR Predict reactive species\nFull Name: melanoma associated antigen (mutated) 1\nCalculated Molecular Weight: 18 kDa, 79 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC008098\nGene Symbol: MUM1\nGene ID (NCBI): 84939\nRRID: AB_10642694\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q2TAK8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869713715369,"sku":"12682-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12682-1-ap","provider":"Iright","version":"1.0","type":"link"}