{"product_id":"proteintech-12683-1-ap","title":"Proteintech, 12683-1-AP, MAD2L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAD2L2 (12683-1-AP) by Proteintech is a Polyclonal antibody targeting MAD2L2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12683-1-AP targets MAD2L2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  A375 cells,  fetal HEK-293 cells,  HeLa cells,  human colon tissue,  human kidney tissue,  K-562 cells,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human ovary tumor tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAD family, together with BUB and Mps1,Cdc20k, play roles in the mitotic spindle checkpoint. MAD2L2 is one of the MAD family. It can mediate the second polymerase switching in translation DNA synthesis by mediating the interaction between the error-prone DNA polymerase zeta catalytic subunit REV3L and the inserter polymerase REV1. Through regulation of the JNK-mediate phosphorylation and activation of the transcriptional activator ELK1, MAD2L2 involves in cellular response to DNA damage. Also it has role in the progression of cell cycle and peithelial-mesenchymal transdifferentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3373 Product name: Recombinant human MAD2L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-211 aa of BC015244 Sequence: TTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS Predict reactive species\nFull Name: MAD2 mitotic arrest deficient-like 2 (yeast)\nCalculated Molecular Weight: 211 aa, 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC015244\nGene Symbol: MAD2L2\nGene ID (NCBI): 10459\nRRID: AB_2139530\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UI95\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879540393,"sku":"12683-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12683-1-ap","provider":"Iright","version":"1.0","type":"link"}