{"product_id":"proteintech-12695-1-ap","title":"Proteintech, 12695-1-AP, LIG4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIG4 (12695-1-AP) by Proteintech is a Polyclonal antibody targeting LIG4 in WB, IHC, ELISA applications with reactivity to human,  mouse, rat samples\n12695-1-AP targets LIG4 in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, mouse liver tissue,  HepG2 cells,  HeLa cells,  rat testis tissue\nPositive IHC detected in: human prostate cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTwo major pathways, homologous recombination (HR) and nonhomologous end joining (NHEJ), counteract one of themost toxic lesions, the DSB. The core protein complex mediating NHEJ in mammals includes DNA ligase IV (Lig4). Lig4 belongs to an ATP-dependent DNA ligase family, and joins single-strand brdownloadeaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. The complex Lig4-XRCC4 is responsible for the NHEJ ligation step, and XRCC4 enhances the joining activity of Lig4.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3385 Product name: Recombinant human LIG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 606-911 aa of BC037491 Sequence: ASGKLASKHLYIGGDDEPQEKKRKAAPKMKKVIGIIEHLKAPNLTNVNKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI Predict reactive species\nFull Name: ligase IV, DNA, ATP-dependent\nCalculated Molecular Weight: 911 aa, 104 kDa\nObserved Molecular Weight: 100-104 kDa\nGenBank Accession Number: BC037491\nGene Symbol: LIG4\nGene ID (NCBI): 3981\nRRID: AB_2136253\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49917\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868862894249,"sku":"12695-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12695-1-ap","provider":"Iright","version":"1.0","type":"link"}