{"product_id":"proteintech-12750-1-ap","title":"Proteintech, 12750-1-AP, IMP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IMP3 (12750-1-AP) by Proteintech is a Polyclonal antibody targeting IMP3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12750-1-AP targets IMP3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIMP U3 small nucleolar ribonucleoprotein 3 (IMP3, BRMS2), is a component of U3 small nucleolar ribonucleoprotein complex (U3 snoRNP), has been identified as a participant in pre-rRNA processing for nearly twenty years.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3477 Product name: Recombinant human IMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC020557 Sequence: MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA Predict reactive species\nFull Name: IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)\nCalculated Molecular Weight: 184 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC020557\nGene Symbol: IMP3\nGene ID (NCBI): 55272\nRRID: AB_2122784\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NV31\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869698248873,"sku":"12750-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12750-1-ap","provider":"Iright","version":"1.0","type":"link"}