{"product_id":"proteintech-12799-1-ap","title":"Proteintech, 12799-1-AP, SMAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMAP1 (12799-1-AP) by Proteintech is a Polyclonal antibody targeting SMAP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12799-1-AP targets SMAP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human adrenal gland tissue,  human plasma sample,  mouse brain tissue,  rat lymph tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMAP1, also named as FLJ13159 and SMAP 1, contains a Arf-GAP domain. SMAP1 is a GTPase activating protein for ARF6 that binds clathrin and regulates clathrin-dependent endocytosis. SMAP1 may play a role in erythropoiesis. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human SMAP1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3544 Product name: Recombinant human SMAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC036123 Sequence: MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTE Predict reactive species\nFull Name: small ArfGAP 1\nCalculated Molecular Weight: 467 aa, 50 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC036123\nGene Symbol: SMAP1\nGene ID (NCBI): 60682\nRRID: AB_2272651\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYB5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887809384617,"sku":"12799-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12799-1-ap","provider":"Iright","version":"1.0","type":"link"}