{"product_id":"proteintech-12812-1-ap","title":"Proteintech, 12812-1-AP, TSPAN12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPAN12 (12812-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN12 in WB, ELISA applications with reactivity to human, mouse, rat samples\n12812-1-AP targets TSPAN12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPAN12 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN12 regulates retinal vascular development by promoting Norrin\/beta-catenin signaling (PMID: 19837033 ). Mutations in TSPAN12 are a relatively frequent cause of familial exudative vitreoretinopathy (FEVR) (PMID: 20159111).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3514 Product name: Recombinant human TSPAN12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-224 aa of BC031265 Sequence: GVWTYEQELMVPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLR Predict reactive species\nFull Name: tetraspanin 12\nCalculated Molecular Weight: 305 aa, 35 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC031265\nGene Symbol: TSPAN12\nGene ID (NCBI): 23554\nRRID: AB_2208667\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95859\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887908901033,"sku":"12812-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12812-1-ap","provider":"Iright","version":"1.0","type":"link"}