{"product_id":"proteintech-12830-1-ap","title":"Proteintech, 12830-1-AP, XK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XK (12830-1-AP) by Proteintech is a Polyclonal antibody targeting XK in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12830-1-AP targets XK in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue,  MCF-7 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXK, also named as XKR1 and XRG1, is responsible for the Kx blood group system. XK forms a functional complex with the Kell glycoprotein. It represents a crucial factor for the maintenance of normal muscle structure and function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3550 Product name: Recombinant human XK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 371-444 aa of BC036019 Sequence: QFFHPCKKLFSSSVSEGFQRWLRCFCWACRQQKPCEPIGKEDLQSSRDRDETPSSSKTSPEPGQFLNAEDLCSA Predict reactive species\nFull Name: X-linked Kx blood group (McLeod syndrome)\nCalculated Molecular Weight: 444 aa, 51 kDa\nObserved Molecular Weight: 45-51 kDa\nGenBank Accession Number: BC036019\nGene Symbol: XK\nGene ID (NCBI): 7504\nRRID: AB_2877887\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51811\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887924891817,"sku":"12830-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12830-1-ap","provider":"Iright","version":"1.0","type":"link"}