{"product_id":"proteintech-12926-1-ap","title":"Proteintech, 12926-1-AP, SKAP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SKAP2 (12926-1-AP) by Proteintech is a Polyclonal antibody targeting SKAP2 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n12926-1-AP targets SKAP2 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, NIH\/3T3 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSKAP2 (src kinase associated phosphoprotein 2), also named PRAP, contains PH domain and SH3 domain. It is localized in cytoplasm and was expressed in ubiquitously in various tissues including lung, skeletal muscle, and spleen, but not detectable in thymus and T cell lymphoma cells. SKAP2 may negatively regulate alpha-synuclein phosphorylation following cell stress. SKAP2 may be involved in B-cell and macrophage adhesion processes by coupling the B-cell receptor (BCR) to integrin activation. Observed MW of SKAP2 is 55 kDa(PMID: 23161539).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3615 Product name: Recombinant human SKAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-359 aa of BC036044 Sequence: MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI Predict reactive species\nFull Name: src kinase associated phosphoprotein 2\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC036044\nGene Symbol: SKAP2\nGene ID (NCBI): 8935\nRRID: AB_2189317\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75563\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868880490665,"sku":"12926-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-12926-1-ap","provider":"Iright","version":"1.0","type":"link"}